PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0616s0110.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 386aa    MW: 43020.7 Da    PI: 8.4731
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0616s0110.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.66.2e-2579122144
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                             d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  SapurV1A.0616s0110.3.p  79 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 122
                             79***************************************997 PP

2QLQ59.78.2e-211044236
                     QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                            +FTa+Q+q+L++Q+l+yKy++++ P+Pp+Ll+ i+
  SapurV1A.0616s0110.3.p 10 PFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIK 44
                            8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-12945IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-151043IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.7411045IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.88879123IPR014977WRC domain
PfamPF088792.1E-2080122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MIMSGGNRFP FTASQWQELE HQALIYKYMV SGIPIPPDLL FTIKRSGCLD SSLSSKLFPR  60
QPPHFSWSCF QMGLGRKIDP EPGRCRRTDG KKWRCSKEAY PDSKYCEKHM HRGKNRSRKP  120
VEVATQSTTA PNVSSITRNH SNNSLLTTSS HSLSLLLPET HHQNHLHYPA PSGYHAHPNH  180
QFLSSSRPLG IGLSPHENST HLLLDSGGPS LSNTDYRNRN VYGLKEEVDE HAFFSESSGS  240
MRSLSGSSLD DASQLSPLTM NSSPSNTNSS KQRSLSGLHN EYSYLQLQSL SDHDTPKQQK  300
QYQHSYLLGS SNIGSLGPIE MEKEKSQKTV HRFFDEWPPE NKDSWLDLAD KSSNSASVST  360
TGLSMSIPSS HDFLPIFSSR TNNDG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00263DAPTransfer from AT2G06200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826621e-132AC182662.2 Populus trichocarpa clone Pop1-15O24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045984.10.0PREDICTED: growth-regulating factor 1 isoform X3
TrEMBLU5GAT50.0U5GAT5_POPTR; Uncharacterized protein
STRINGPOPTR_0006s14560.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-57growth-regulating factor 5